PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016473035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 469aa    MW: 54153.1 Da    PI: 8.4323
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016473035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.57.4e-161695999
                    HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k+g l +pk f+ ++  +++++e+   t   ++g++W vkl  ++++    l++GW++F+++++L+ gD +vFk++g++ef   v +f++
  XP_016473035.1 16 PGFKQG-LKIPKGFL-KYlkDHDHNEH--AT-LRRDGKKWLVKL--NGRR----LEEGWEKFAEEHDLQLGDLLVFKHEGNMEF--EVIIFDS 95
                    455665.*******9.77564444444..44.347*********..8888....*************************99999..7777775 PP

2B351.12.5e-16144226490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      +++s++l++g l++p +fa+++g+  + + +l+++de+ rsW++kl    +  ++++++ W +F  an+Lk+gD ++F+++ + ++
  XP_016473035.1 144 CTVRSYYLTNGYLRVPSRFASKNGLTYK-KCDLIIRDERQRSWNLKL--YTSCHHVYIGGRWAKFHAANDLKVGDRIMFEVVTN-GE 226
                     5678*******************88754.459***************..999999*************************8764.33 PP

3B346.95.1e-15328412593
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     +++++ l+ + l+lp +fa ++g+++++  +l+++de+ rsW++ l  r  + ++ +++GW++F + + LkegD ++F+++  +++++v
  XP_016473035.1 328 TIRPYCLTYSYLILPTQFALTNGLINKK-CDLIIRDEWQRSWNLML--RPFGTSVCIRGGWRNFRDTHCLKEGDQIMFEVVT-DGTKPV 412
                     56788999999***********988654.59***************..*******************************876.455555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-21498IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.915796IPR003340B3 DNA binding domain
SuperFamilySSF1019364.32E-207102IPR015300DNA-binding pseudobarrel domain
CDDcd100171.35E-17894No hitNo description
SMARTSM010197.3E-201096IPR003340B3 DNA binding domain
PfamPF023622.1E-121894IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-16139232IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-17140233IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.787141235IPR003340B3 DNA binding domain
SMARTSM010191.8E-8142236IPR003340B3 DNA binding domain
PfamPF023621.9E-14145227IPR003340B3 DNA binding domain
CDDcd100179.07E-13147220No hitNo description
SuperFamilySSF1019361.26E-17321415IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-16321415IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.237324418IPR003340B3 DNA binding domain
SMARTSM010192.6E-12325419IPR003340B3 DNA binding domain
PfamPF023625.7E-13328413IPR003340B3 DNA binding domain
CDDcd100175.49E-13339412No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MKIPPVKPHF FKPIQPGFKQ GLKIPKGFLK YLKDHDHNEH ATLRRDGKKW LVKLNGRRLE  60
EGWEKFAEEH DLQLGDLLVF KHEGNMEFEV IIFDSSHCDR EYAEYLQEEE DIVEGACKKF  120
ELKDGFPHAE GATHNPFGQS HFECTVRSYY LTNGYLRVPS RFASKNGLTY KKCDLIIRDE  180
RQRSWNLKLY TSCHHVYIGG RWAKFHAAND LKVGDRIMFE VVTNGERPIW KFHVKPNPSI  240
KSSSKAFPYA EAATHKPFGH SHLDSRHCNR EYVEYLQEEE EAASDAVEGT SKEFELKDEP  300
NPSVKSSSKA FPHVEAAIHK PFGHFVCTIR PYCLTYSYLI LPTQFALTNG LINKKCDLII  360
RDEWQRSWNL MLRPFGTSVC IRGGWRNFRD THCLKEGDQI MFEVVTDGTK PVWKFHGVAG  420
KEVVSCMMFW VLFLGHWNNK GVICSCILIS LKISRGLLTS KNCCTKGSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016473035.10.0PREDICTED: B3 domain-containing protein REM5-like isoform X1
TrEMBLK4CIB31e-147K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-146(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-41B3 family protein